Lineage for d4hvfd_ (4hvf D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899481Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (4 PDB entries)
  8. 1899485Domain d4hvfd_: 4hvf D: [227943]
    automated match to d4dkma_
    complexed with gol

Details for d4hvfd_

PDB Entry: 4hvf (more details), 1.7 Å

PDB Description: crystal structure of green fluorescent protein langfp(branchiostoma lanceolatum)
PDB Compounds: (D:) Green fluorescent protein blFP-Y6

SCOPe Domain Sequences for d4hvfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hvfd_ d.22.1.0 (D:) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
hhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwil
vpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthik
gefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvr
snftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm

SCOPe Domain Coordinates for d4hvfd_:

Click to download the PDB-style file with coordinates for d4hvfd_.
(The format of our PDB-style files is described here.)

Timeline for d4hvfd_: