Lineage for d4hpxb_ (4hpx B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) 
Protein Tryptophan synthase, beta-subunit [53688] (4 species) 
Species Salmonella enterica [TaxId:90371] [229810] (8 PDB entries) 
Domain d4hpxb_: 4hpx B: [229813]
Other proteins in same PDB: d4hpxa_
automated match to d1kfjb_
complexed with 0jo, bcn, bzi, cs, f9f, peg
Details for d4hpxb_
PDB Entry: 4hpx (more details), 1.65 Å
PDB Description: crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site
PDB Compounds: (B:) tryptophan synthase beta chainSCOPe Domain Sequences for d4hpxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hpxb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge
SCOPe Domain Coordinates for d4hpxb_:
Click to download the PDB-style file with coordinates for d4hpxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hpxb_:
- d4hpxb_ first appeared in SCOPe 2.03
- d4hpxb_ appears in SCOPe 2.07
View in 3D
