Lineage for d4hpna1 (4hpn A:1-123)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.0: automated matches [227195] (1 protein)
not a true familyProtein automated matches [226922] (95 species)
not a true protein
Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries) 
Domain d4hpna1: 4hpn A:1-123 [252481]
Other proteins in same PDB: d4hpna2
automated match to d3sjna1
complexed with ca, imd, ni
Details for d4hpna1
PDB Entry: 4hpn (more details), 1.6 Å
PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops
PDB Compounds: (A:) Putative uncharacterized proteinSCOPe Domain Sequences for d4hpna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hpna1 d.54.1.0 (A:1-123) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mkitavrthllehrldtpfesasmrfdrrahvlveiecddgtvgwgeclgparpnaavvq
aysgwligqdprqtekiwavlynalrdqgqrglsltalsgidialwdikgkhygasisml
lgg
SCOPe Domain Coordinates for d4hpna1:
Click to download the PDB-style file with coordinates for d4hpna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hpna1:
- d4hpna1 first appeared in SCOPe 2.04
- d4hpna1 appears in SCOPe 2.07
View in 3D
