Lineage for d4hlsb_ (4hls B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.6: Prion-like [54097] (1 superfamily)
beta-alpha-beta-alpha(2); antiparallel beta-ribbonSuperfamily d.6.1: Prion-like [54098] (1 family) 
Family d.6.1.1: Prion-like [54099] (3 proteins) Protein automated matches [191016] (9 species)
not a true proteinSpecies Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries) 
Domain d4hlsb_: 4hls B: [222661]
automated match to d1xywa_
complexed with cl, gol, na; mutant
Details for d4hlsb_
PDB Entry: 4hls (more details), 1.45 Å
PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S170N)
PDB Compounds: (B:) major prion proteinSCOPe Domain Sequences for d4hlsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlsb_ d.6.1.1 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa
SCOPe Domain Coordinates for d4hlsb_:
Click to download the PDB-style file with coordinates for d4hlsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hlsb_:
- d4hlsb_ first appeared in SCOPe 2.03
- d4hlsb_ appears in SCOPe 2.04
- d4hlsb_ appears in SCOPe 2.06
- d4hlsb_ appears in the current release, SCOPe 2.08
View in 3D
