Lineage for d4hkyb_ (4hky B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (15 species)
not a true proteinSpecies Klebsiella pneumoniae [TaxId:573] [189718] (29 PDB entries) 
Domain d4hkyb_: 4hky B: [193278]
automated match to d3srxa_
complexed with cd, cl, fpm, gol, sfr
Details for d4hkyb_
PDB Entry: 4hky (more details), 2 Å
PDB Description: new delhi metallo-beta-lactamase-1, complexed with cd and faropenem
PDB Compounds: (B:) Beta-lactamase NDM-1SCOPe Domain Sequences for d4hkyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hkyb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
airptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r
SCOPe Domain Coordinates for d4hkyb_:
Click to download the PDB-style file with coordinates for d4hkyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hkyb_:
- d4hkyb_ first appeared in SCOPe 2.02
- d4hkyb_ appears in SCOPe 2.04
- d4hkyb_ is called d4hkyb1 in SCOPe 2.06
- d4hkyb_ appears in the current release, SCOPe 2.08, called d4hkyb1
View in 3D
