Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Drosophila mojavensis [TaxId:7230] [226515] (1 PDB entry) |
Domain d4hi7b1: 4hi7 B:1-87 [222620] Other proteins in same PDB: d4hi7a2, d4hi7a3, d4hi7b2 automated match to d1r5aa2 complexed with gsh |
PDB Entry: 4hi7 (more details), 1.25 Å
SCOPe Domain Sequences for d4hi7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hi7b1 c.47.1.0 (B:1-87) automated matches {Drosophila mojavensis [TaxId: 7230]} mvkpilygidasppvravkltlaalqlpydykivnlmnkeqhseeylkknpqhtvplled gdaniadshaimaylvskygkddslyp
Timeline for d4hi7b1: