Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (27 species) not a true protein |
Species Halys viper (Agkistrodon halys) [TaxId:8714] [194477] (1 PDB entry) |
Domain d4hg9c_: 4hg9 C: [194478] automated match to d1jiaa_ complexed with ca, cit, g3p, gol |
PDB Entry: 4hg9 (more details), 1.6 Å
SCOPe Domain Sequences for d4hg9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hg9c_ a.133.1.2 (C:) automated matches {Halys viper (Agkistrodon halys) [TaxId: 8714]} hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse kc
Timeline for d4hg9c_: