Lineage for d4hana2 (4han A:155-317)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781099Domain d4hana2: 4han A:155-317 [252412]
    Other proteins in same PDB: d4hana3, d4hanb3
    automated match to d3ap6d_
    complexed with nad, peg

Details for d4hana2

PDB Entry: 4han (more details), 2.55 Å

PDB Description: crystal structure of galectin 8 with ndp52 peptide
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d4hana2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hana2 b.29.1.0 (A:155-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrlpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafv
rnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssi
dtleingdihllevrsw

SCOPe Domain Coordinates for d4hana2:

Click to download the PDB-style file with coordinates for d4hana2.
(The format of our PDB-style files is described here.)

Timeline for d4hana2: