Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Leishmania major [TaxId:347515] [226494] (1 PDB entry) |
Domain d4h51b_: 4h51 B: [222388] automated match to d7aata_ complexed with edo |
PDB Entry: 4h51 (more details), 1.85 Å
SCOPe Domain Sequences for d4h51b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h51b_ c.67.1.0 (B:) automated matches {Leishmania major [TaxId: 347515]} mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll ldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtgavslgaklltrvfd aettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfi lhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrg ievllaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlah lilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglsk aqceycqnhnifitvsgranmaglthetalmlaqtindavrnv
Timeline for d4h51b_: