Lineage for d4h49c_ (4h49 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529954Protein automated matches [190182] (1 species)
    not a true protein
  7. 2529955Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2529994Domain d4h49c_: 4h49 C: [192934]
    Other proteins in same PDB: d4h49a2, d4h49b2, d4h49d2
    automated match to d1os9a_
    complexed with ca, dms, gol, l29, peg, pgo, zn

Details for d4h49c_

PDB Entry: 4h49 (more details), 2.16 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a twin inhibitor.
PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h49c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h49c_ d.92.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga
hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglg
hssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d4h49c_:

Click to download the PDB-style file with coordinates for d4h49c_.
(The format of our PDB-style files is described here.)

Timeline for d4h49c_: