Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
Domain d4h25a1: 4h25 A:3-81 [228334] Other proteins in same PDB: d4h25a2, d4h25b1, d4h25b2, d4h25b3, d4h25b4, d4h25d2, d4h25e1, d4h25e2, d4h25e3, d4h25e4 automated match to d1kg0a2 complexed with ipa |
PDB Entry: 4h25 (more details), 2.2 Å
SCOPe Domain Sequences for d4h25a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h25a1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d4h25a1: