Lineage for d4h25a1 (4h25 A:3-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545290Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2545300Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2545302Domain d4h25a1: 4h25 A:3-81 [228334]
    Other proteins in same PDB: d4h25a2, d4h25b1, d4h25b2, d4h25b3, d4h25b4, d4h25d2, d4h25e1, d4h25e2, d4h25e3, d4h25e4
    automated match to d1kg0a2
    complexed with ipa

Details for d4h25a1

PDB Entry: 4h25 (more details), 2.2 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insights to nickel contact allergy
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h25a1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d4h25a1:

Click to download the PDB-style file with coordinates for d4h25a1.
(The format of our PDB-style files is described here.)

Timeline for d4h25a1:

2545302
d4h25a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4h25a2