Lineage for d4h0fa_ (4h0f A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.92: Chelatase-like [53799] (3 superfamilies)
duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) 
contains a long alpha helical insertion in the interdomain linker
Family c.92.2.0: automated matches [191548] (1 protein)
not a true familyProtein automated matches [190944] (35 species)
not a true protein
Species Streptococcus agalactiae [TaxId:208435] [227693] (1 PDB entry) 
Domain d4h0fa_: 4h0f A: [227694]
automated match to d3ztta_
complexed with zn; mutant
Details for d4h0fa_
PDB Entry: 4h0f (more details), 2.4 Å
PDB Description: mutant structure of laminin-binding adhesin (lmb) from streptococcus agalactiae
PDB Compounds: (A:) Laminin-binding surface proteinSCOPe Domain Sequences for d4h0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0fa_ c.92.2.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
gmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhshtl
eawardldpnlkkskvnvfeaskpltldrvkpgatvydphtwtdpvlageeavniakelg
hldpkhkdsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlg
isgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlsplea
apsgnktylenlranlevlyqqlk
SCOPe Domain Coordinates for d4h0fa_:
Click to download the PDB-style file with coordinates for d4h0fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4h0fa_:
- d4h0fa_ first appeared in SCOPe 2.03
- d4h0fa_ appears in SCOPe 2.05
- d4h0fa_ appears in SCOPe 2.07
- d4h0fa_ appears in the current release, SCOPe 2.08
View in 3D
