Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (14 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [228435] (1 PDB entry) |
Domain d4guzd_: 4guz D: [228437] automated match to d1gx3a_ |
PDB Entry: 4guz (more details), 1.8 Å
SCOPe Domain Sequences for d4guzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4guzd_ d.3.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]} vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq
Timeline for d4guzd_: