Lineage for d4gota_ (4got A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915269Species Bacillus subtilis [TaxId:224308] [194551] (7 PDB entries)
  8. 2915275Domain d4gota_: 4got A: [194552]
    automated match to d1xs5a_
    complexed with mse, so4

Details for d4gota_

PDB Entry: 4got (more details), 1.95 Å

PDB Description: crystal structure of a putative methionine-binding lipoprotein (bsu32730) from bacillus subtilis subsp. subtilis str. 168 at 1.95 a resolution
PDB Compounds: (A:) Methionine-binding lipoprotein metQ

SCOPe Domain Sequences for d4gota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gota_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
sgkkeivvaatktphaeilkeaepllkekgytlkvkvlsdykmynkaladkevdanyfqh
ipyleqemkentdyklvnagavhlepfgiysktykslkdlpdgatiiltnnvaeqgrmla
mlenaglitldskvetvdatlkdikknpknlefkkvapeltakayenkegdavfinvnya
iqnklnpkkdaievestknnpyaniiavrkgeedsakikalmevlhskkikdfiekkydg
avlpvse

SCOPe Domain Coordinates for d4gota_:

Click to download the PDB-style file with coordinates for d4gota_.
(The format of our PDB-style files is described here.)

Timeline for d4gota_: