Lineage for d4gnwa_ (4gnw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804848Species Rhodnius prolixus [TaxId:13249] [187425] (3 PDB entries)
  8. 2804850Domain d4gnwa_: 4gnw A: [227915]
    automated match to d1sy3a_
    complexed with hem, nh3, po4; mutant

Details for d4gnwa_

PDB Entry: 4gnw (more details), 1.15 Å

PDB Description: Crystal structure of nitrophorin 4 triple mutant complex with ammonia
PDB Compounds: (A:) Nitrophorin-4

SCOPe Domain Sequences for d4gnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gnwa_ b.60.1.1 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdylnlqpdnvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d4gnwa_:

Click to download the PDB-style file with coordinates for d4gnwa_.
(The format of our PDB-style files is described here.)

Timeline for d4gnwa_: