Lineage for d4glla_ (4gll A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (239 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries) 
Domain d4glla_: 4gll A: [221986]
automated match to d2hunb_
complexed with gai, nad, so4
Details for d4glla_
PDB Entry: 4gll (more details), 2.5 Å
PDB Description: crystal structure of human udp-xylose synthase.
PDB Compounds: (A:) UDP-glucuronic acid decarboxylase 1SCOPe Domain Sequences for d4glla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4glla_ c.2.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
plyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevyg
dpevhpqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmh
mndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpe
ehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnka
ihyfrke
SCOPe Domain Coordinates for d4glla_:
Click to download the PDB-style file with coordinates for d4glla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4glla_:
- d4glla_ first appeared in SCOPe 2.03
- d4glla_ appears in SCOPe 2.05
- d4glla_ appears in SCOPe 2.07
- d4glla_ appears in the current release, SCOPe 2.08
View in 3D
