Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Acinetobacter baumannii [TaxId:509173] [227366] (7 PDB entries) |
Domain d4gkia_: 4gki A: [227394] automated match to d3tm0a_ complexed with 0jn, act, cl, kan, na, peg |
PDB Entry: 4gki (more details), 1.88 Å
SCOPe Domain Sequences for d4gkia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gkia_ d.144.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 509173]} gmshiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkg svandvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgen ivdalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvw kemhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgef spslqkrlfqkygidnpdmnklqfhlmldeff
Timeline for d4gkia_: