Lineage for d4gebb_ (4geb B:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.0: automated matches [191328] (1 protein)
not a true familyProtein automated matches [190151] (66 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188446] (16 PDB entries) 
Domain d4gebb_: 4geb B: [193065]
automated match to d2r2na_
complexed with 0ld, so4
Details for d4gebb_
PDB Entry: 4geb (more details), 2.15 Å
PDB Description: Kynurenine Aminotransferase II Inhibitors
PDB Compounds: (B:) kynurenine/alpha-aminoadipate aminotransferase, mitochondrialSCOPe Domain Sequences for d4gebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gebb_ c.67.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
ikesllvp
SCOPe Domain Coordinates for d4gebb_:
Click to download the PDB-style file with coordinates for d4gebb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gebb_:
- d4gebb_ first appeared in SCOPe 2.02
- d4gebb_ appears in SCOPe 2.04
- d4gebb_ appears in the current release, SCOPe 2.08, called d4gebb1
View in 3D
