Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
Protein automated matches [194413] (5 species) not a true protein |
Species Aspergillus nidulans [TaxId:227321] [194414] (2 PDB entries) |
Domain d4g92b_: 4g92 B: [194415] automated match to d1n1ja_ protein/DNA complex; complexed with so4 |
PDB Entry: 4g92 (more details), 1.8 Å
SCOPe Domain Sequences for d4g92b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g92b_ a.22.1.3 (B:) automated matches {Aspergillus nidulans [TaxId: 227321]} mkeqdrwlpianvarimklalpenakiakeakecmqecvsefisfitseasekcqqekrk tvngedilfamtslgfenyaealkiylskyre
Timeline for d4g92b_: