Details for d4g4sc_

PDB Entry: 4g4s (more details), 2.49 Å

PDB Compounds: (C:) Proteasome component Y13

SCOPe Domain Sequences for d4g4sc_:

Sequence, based on SEQRES records: (download)

>d4g4sc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtstek
lyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqh
gglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmk
vddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit

Sequence, based on observed residues (ATOM records): (download)

>d4g4sc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtstek
lyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqh
gglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmk
vddaielalktlskttdltydrlefatirkgandgevyqkifkpqeikdilvktgit

SCOPe Domain Coordinates for d4g4sc_:

Timeline for d4g4sc_:

• d4g4sc_ first appeared in SCOPe 2.03
  
• d4g4sc_ appears in SCOPe 2.05
  
• d4g4sc_ appears in the current release, SCOPe 2.08
  

Thumbnails for d4g4sc_:

d4g4sc_ (click for larger image) View in 3D

d4g4sc_ in context of chain View in 3D

d4g4sc_ in context of PDB d4g4sa_ in context of PDB d4g4sb_ in context of PDB d4g4sd_ in context of PDB d4g4se_ in context of PDB d4g4sf_ in context of PDB d4g4sg_ in context of PDB d4g4sh_ in context of PDB d4g4si_ in context of PDB d4g4sj_ in context of PDB d4g4sk_ in context of PDB d4g4sl_ in context of PDB d4g4sm_ in context of PDB d4g4sn_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d4g4sa_, d4g4sb_, d4g4sd_, d4g4se_, d4g4sf_, d4g4sg_, d4g4sh_, d4g4si_, d4g4sj_, d4g4sk_, d4g4sl_, d4g4sm_, d4g4sn_