Lineage for d4g36b_ (4g36 B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2222614Species Firefly (Photinus pyralis) [TaxId:7054] [193585] (8 PDB entries)
  8. 2222619Domain d4g36b_: 4g36 B: [202169]
    automated match to d4g36a_
    complexed with slu

Details for d4g36b_

PDB Entry: 4g36 (more details), 2.62 Å

PDB Description: Photinus pyralis luciferase in the adenylate-forming conformation bound to DLSA
PDB Compounds: (B:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d4g36b_:

Sequence, based on SEQRES records: (download)

>d4g36b_ e.23.1.1 (B:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpf
hhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
kggkskl

Sequence, based on observed residues (ATOM records): (download)

>d4g36b_ e.23.1.1 (B:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvvpfhhgf
gmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
edehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaavvvl
ehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakkggk
skl

SCOPe Domain Coordinates for d4g36b_:

Click to download the PDB-style file with coordinates for d4g36b_.
(The format of our PDB-style files is described here.)

Timeline for d4g36b_: