Lineage for d4fg8b_ (4fg8 B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the commentsProtein automated matches [190091] (11 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries) 
Domain d4fg8b_: 4fg8 B: [193279]
automated match to d1a06a_
complexed with atp
Details for d4fg8b_
PDB Entry: 4fg8 (more details), 2.2 Å
PDB Description: Crystal structure of human calcium/calmodulin-dependent protein kinase I 1-315 in complex with ATP
PDB Compounds: (B:) Calcium/calmodulin-dependent protein kinase type 1SCOPe Domain Sequences for d4fg8b_:
Sequence, based on SEQRES records: (download)
>d4fg8b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edirdiydfrdvlgtgafsevilaedkrtqklvaikciakealegkegsmeneiavlhki
khpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylh
dlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacgtpgyvapevlaqk
pyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdspywddisdsakdfi
rhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfa
Sequence, based on observed residues (ATOM records): (download)
>d4fg8b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edirdiydfrdvlgtgafsevilaedkrtqklvaikciakneiavlhkikhpnivalddi
yesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivhrdlkp
enllyysldedskimisdfggsvlstacgtpgyvapevlaqkpyskavdcwsigviayil
lcgyppfydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqal
qhpwiagdtaldknihqsvseqikknfa
SCOPe Domain Coordinates for d4fg8b_:
Click to download the PDB-style file with coordinates for d4fg8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fg8b_:
- d4fg8b_ first appeared in SCOPe 2.02
- d4fg8b_ appears in SCOPe 2.04
- d4fg8b_ appears in the current release, SCOPe 2.08
View in 3D
