Lineage for d4f8da_ (4f8d A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
core: 4 helices; folded leaf, closedSuperfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) 
Family a.35.1.0: automated matches [191534] (1 protein)
not a true familyProtein automated matches [190907] (8 species)
not a true proteinSpecies Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries) 
Domain d4f8da_: 4f8d A: [196769]
automated match to d3s8qb_
complexed with na, so4; mutant
Details for d4f8da_
PDB Entry: 4f8d (more details), 1.5 Å
PDB Description: Crystal Structure of an R46A mutant of the Restriction-Modification Controller Protein C.Esp1396I (Monoclinic Form)
PDB Compounds: (A:) Regulatory proteinSCOPe Domain Sequences for d4f8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f8da_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsanltikslelimkgle
vsdvvffemlikeilkhd
SCOPe Domain Coordinates for d4f8da_:
Click to download the PDB-style file with coordinates for d4f8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f8da_:
- d4f8da_ first appeared in SCOPe 2.02
- d4f8da_ appears in SCOPe 2.04
- d4f8da_ appears in SCOPe 2.06
- d4f8da_ appears in the current release, SCOPe 2.08
View in 3D
