Lineage for d4f3ja_ (4f3j A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779444Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 1779445Protein automated matches [190873] (3 species)
    not a true protein
  7. 1779446Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)
  8. 1779447Domain d4f3ja_: 4f3j A: [194367]
    automated match to d1c3ha_

Details for d4f3ja_

PDB Entry: 4f3j (more details), 1.34 Å

PDB Description: Crystal Structure of Trimeric gC1q Domain of Human C1QTNF5 associated with Late-onset Retinal Macular Degeneration
PDB Compounds: (A:) Complement C1q tumor necrosis factor-related protein 5

SCOPe Domain Sequences for d4f3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3ja_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
ktdstfsgflvysdwhsspvfah

SCOPe Domain Coordinates for d4f3ja_:

Click to download the PDB-style file with coordinates for d4f3ja_.
(The format of our PDB-style files is described here.)

Timeline for d4f3ja_: