Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries) |
Domain d4f38a_: 4f38 A: [195316] Other proteins in same PDB: d4f38b_ automated match to d1cc0a_ complexed with ger, gnp, mg |
PDB Entry: 4f38 (more details), 2.8 Å
SCOPe Domain Sequences for d4f38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f38a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq arrgkkksgc
Timeline for d4f38a_: