Lineage for d4eq1a_ (4eq1 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.0: automated matches [191387] (1 protein)
not a true familyProtein automated matches [190492] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187434] (18 PDB entries) 
Domain d4eq1a_: 4eq1 A: [196838]
automated match to d3h82b_
complexed with pe5
Details for d4eq1a_
PDB Entry: 4eq1 (more details), 1.6 Å
PDB Description: crystal structure of the arnt pas-b homodimer
PDB Compounds: (A:) Aryl hydrocarbon receptor nuclear translocatorSCOPe Domain Sequences for d4eq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eq1a_ d.110.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvcqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqv
vklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnv
SCOPe Domain Coordinates for d4eq1a_:
Click to download the PDB-style file with coordinates for d4eq1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4eq1a_:
- d4eq1a_ first appeared in SCOPe 2.02
- d4eq1a_ appears in SCOPe 2.04
- d4eq1a_ is called d4eq1a1 in SCOPe 2.06
- d4eq1a_ appears in the current release, SCOPe 2.08, called d4eq1a1
View in 3D
