Lineage for d4ekva_ (4ekv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806404Domain d4ekva_: 4ekv A: [234393]
    automated match to d4bx5a_
    complexed with btn, cl

Details for d4ekva_

PDB Entry: 4ekv (more details), 2 Å

PDB Description: streptavidin 8-aa-loop h127c mutein with reversible biotin binding
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d4ekva_:

Sequence, based on SEQRES records: (download)

>d4ekva_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
algwtvawknnyrnahsattwsgqyvggaearintqwlltsgdssngsdgstlvgcdtft
kvkpsaasidaa

Sequence, based on observed residues (ATOM records): (download)

>d4ekva_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
algwtvawknnyrnahsattwsgqyvggaearintqwlltsstlvgcdtftkvkpsaasi
daa

SCOPe Domain Coordinates for d4ekva_:

Click to download the PDB-style file with coordinates for d4ekva_.
(The format of our PDB-style files is described here.)

Timeline for d4ekva_: