Lineage for d4eeua_ (4eeu A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922630Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1922761Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 1922780Protein automated matches [190943] (2 species)
    not a true protein
  7. 1922787Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (10 PDB entries)
  8. 1922790Domain d4eeua_: 4eeu A: [195381]
    automated match to d1jnua_
    complexed with fmn

Details for d4eeua_

PDB Entry: 4eeu (more details), 1.41 Å

PDB Description: Crystal structure of phiLOV2.1
PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d4eeua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eeua_ d.110.3.6 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fieksfvitdprlpdypiifasdgflelteysreeimgrnarflqgpetdqatvqkirda
irdqrettvqlinytksgkkfwnllhlqpvrdrkgglqyfigvqlvgsd

SCOPe Domain Coordinates for d4eeua_:

Click to download the PDB-style file with coordinates for d4eeua_.
(The format of our PDB-style files is described here.)

Timeline for d4eeua_: