Lineage for d4eeja_ (4eej A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interior
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
ten-stranded meander beta-sheet folded upon itself
relates to the common fold by opening the barrel and insertion of beta-hairpin
Protein automated matches [190295] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries) 
Domain d4eeja_: 4eej A: [194190]
automated match to d2rcta_
complexed with act, ret; mutant
Details for d4eeja_
PDB Entry: 4eej (more details), 1.5 Å
PDB Description: crystal structure of the q108k:k40l:t51v:t53c:y19w:r58w:t29l:q4r mutant of cellular retinol binding protein type ii in complex with all-trans-retinal at 1.5 angstrom resolution
PDB Compounds: (A:) Retinol-binding protein 2SCOPe Domain Sequences for d4eeja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eeja_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdrngtwemesnenfegwmkaldidfalrkiavrltqtlvidqdgdnfkvkctstfwny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk
SCOPe Domain Coordinates for d4eeja_:
Click to download the PDB-style file with coordinates for d4eeja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4eeja_:
- d4eeja_ first appeared in SCOPe 2.02
- d4eeja_ appears in SCOPe 2.07
View in 3D
