Lineage for d4e7ob_ (4e7o B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.0: automated matches [191324] (1 protein)
not a true familyProtein automated matches [190131] (59 species)
not a true protein
Species Streptococcus pneumoniae [TaxId:171101] [226388] (2 PDB entries) 
Domain d4e7ob_: 4e7o B: [220355]
automated match to d3ffwa_
complexed with mg
Details for d4e7ob_
PDB Entry: 4e7o (more details), 2.2 Å
PDB Description: Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae
PDB Compounds: (B:) Response regulatorSCOPe Domain Sequences for d4e7ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e7ob_ c.23.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
hmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvk
tglevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvle
grkeyspelme
SCOPe Domain Coordinates for d4e7ob_:
Click to download the PDB-style file with coordinates for d4e7ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4e7ob_:
- d4e7ob_ first appeared in SCOPe 2.03
- d4e7ob_ appears in SCOPe 2.04
- d4e7ob_ is called d4e7ob1 in SCOPe 2.06
- d4e7ob_ appears in the current release, SCOPe 2.08, called d4e7ob1
View in 3D
