Lineage for d4e4va_ (4e4v A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelixSuperfamily a.118.1: ARM repeat [48371] (26 families) 
Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
Protein automated matches [190070] (3 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187211] (16 PDB entries) 
Domain d4e4va_: 4e4v A: [251663]
automated match to d1q1sc_
complexed with dtt, gol
Details for d4e4va_
PDB Entry: 4e4v (more details), 2.53 Å
PDB Description: the crystal structure of the dimeric human importin alpha 1 at 2.5 angstrom resolution.
PDB Compounds: (A:) Importin subunit alpha-2SCOPe Domain Sequences for d4e4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4va_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mldalnqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkf
vsflgrtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavw
algniagdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpap
pidaveqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllga
selpivtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnita
grqdqiqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiiep
lmnlltakdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesv
yraslsliekyfs
SCOPe Domain Coordinates for d4e4va_:
Click to download the PDB-style file with coordinates for d4e4va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4e4va_:
- d4e4va_ first appeared in SCOPe 2.04
- d4e4va_ is called d4e4va1 in SCOPe 2.06
- d4e4va_ appears in the current release, SCOPe 2.08, called d4e4va1
View in 3D
