Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.60: C-3'-methyltransferase-like [310657] (2 proteins) Pfam PF08421; Pfam PF13489; Pfam PF08484 (in that order in the sequence) |
Protein TcaB9 [310820] (1 species) |
Species Micromonospora chalcea [TaxId:1874] [311087] (10 PDB entries) |
Domain d4e2xa_: 4e2x A: [307272] automated match to d3ndja_ complexed with edo, sah, tyd, zn; mutant |
PDB Entry: 4e2x (more details), 1.4 Å
SCOPe Domain Sequences for d4e2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e2xa_ c.66.1.60 (A:) TcaB9 {Micromonospora chalcea [TaxId: 1874]} ptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprd lmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvr hlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvl egvdallapdgvfvfedpylgdivaktsfdqifdehfflfsatsvqgmaqrcgfelvdvq rlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltal lhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpas afsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir
Timeline for d4e2xa_: