Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4dzbb2: 4dzb B:118-245 [220122] Other proteins in same PDB: d4dzba1, d4dzbb1 automated match to d1ktke2 |
PDB Entry: 4dzb (more details), 1.7 Å
SCOPe Domain Sequences for d4dzbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dzbb2 b.1.1.2 (B:118-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d4dzbb2: