![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein automated matches [226972] (9 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:235909] [226400] (6 PDB entries) |
![]() | Domain d4dqqa2: 4dqq A:469-876 [219951] Other proteins in same PDB: d4dqqa1, d4dqqd1 automated match to d2hhva2 protein/DNA complex; complexed with ctp, mes, mg, mpd, so4 |
PDB Entry: 4dqq (more details), 1.59 Å
SCOPe Domain Sequences for d4dqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dqqa2 e.8.1.1 (A:469-876) automated matches {Geobacillus kaustophilus [TaxId: 235909]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqialrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d4dqqa2: