Lineage for d4dpoa_ (4dpo A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.0: automated matches [191316] (1 protein)
not a true familyProtein automated matches [190081] (19 species)
not a true protein
Species Methanosarcina mazei [TaxId:192952] [226315] (1 PDB entry) 
Domain d4dpoa_: 4dpo A: [219923]
automated match to d1x7vc_
Details for d4dpoa_
PDB Entry: 4dpo (more details), 2.73 Å
PDB Description: crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1
PDB Compounds: (A:) conserved proteinSCOPe Domain Sequences for d4dpoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dpoa_ d.58.4.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
nlyfqsmlairvvaknqvkpekvqefmnlckslieetlkeegcidygvyqelenpeiltm
leewkdegsldqhirsdhfkeifpllsecldketeiniyrkk
SCOPe Domain Coordinates for d4dpoa_:
Click to download the PDB-style file with coordinates for d4dpoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dpoa_:
- d4dpoa_ first appeared in SCOPe 2.03
- d4dpoa_ appears in SCOPe 2.05
- d4dpoa_ appears in the current release, SCOPe 2.08, called d4dpoa1
View in 3D
