Lineage for d4dheb_ (4dhe B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (96 species)
not a true protein
Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries) 
Domain d4dheb_: 4dhe B: [196069]
automated match to d1puia_
complexed with cl
Details for d4dheb_
PDB Entry: 4dhe (more details), 2.2 Å
PDB Description: Crystal structure of a probable GTP-binding protein engB from Burkholderia thailandensis
PDB Compounds: (B:) Probable GTP-binding protein engBSCOPe Domain Sequences for d4dheb_:
Sequence, based on SEQRES records: (download)
>d4dheb_ c.37.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafasktp
grtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmilm
mdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdagya
gkltvqlfsalkrtglddahalieswlr
Sequence, based on observed residues (ATOM records): (download)
>d4dheb_ c.37.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafahiny
fsvgpaaepvahlvdlpgykahweqllssylqtrpqlcgmilmmdarrplteldrrmiew
faptgkpihslltkcdkltrqesinalratqksldayrdagyagkltvqlfsalkrtgld
dahalieswlr
SCOPe Domain Coordinates for d4dheb_:
Click to download the PDB-style file with coordinates for d4dheb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dheb_:
- d4dheb_ first appeared in SCOPe 2.02
- d4dheb_ appears in SCOPe 2.04
- d4dheb_ is called d4dheb1 in SCOPe 2.06
- d4dheb_ appears in the current release, SCOPe 2.08, called d4dheb1
View in 3D
