Lineage for d4da9b_ (4da9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108729Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)
  8. 2108760Domain d4da9b_: 4da9 B: [219636]
    Other proteins in same PDB: d4da9a2, d4da9c2
    automated match to d3ri3b_
    complexed with so4

Details for d4da9b_

PDB Entry: 4da9 (more details), 2.5 Å

PDB Description: Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
PDB Compounds: (B:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d4da9b_:

Sequence, based on SEQRES records: (download)

>d4da9b_ c.2.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
qkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarviflr
adladlsshqatvdavvaefgridclvnnagiasivrddfldlkpenfdtivgvnlrgtv
fftqavlkamlasdarasrsiinitsvsavmtsperldycmskaglaafsqglalrlaet
giavfevrpgiirsdmtaavsgkydgliesglvpmrrwgepedignivaglaggqfgfat
gsviqadgglsigr

Sequence, based on observed residues (ATOM records): (download)

>d4da9b_ c.2.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
qkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarviflr
adladlsshqatvdavvaefgridclvnnagiddfldlkpenfdtivgvnlrgtvfftqa
vlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrpgiw
gepedignivaglaggqfgfatgsviqadgglsigr

SCOPe Domain Coordinates for d4da9b_:

Click to download the PDB-style file with coordinates for d4da9b_.
(The format of our PDB-style files is described here.)

Timeline for d4da9b_: