Lineage for d4cr2w_ (4cr2 W:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468413Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2468414Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2468415Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2468536Protein Proteasome regulatory subunit Rpn10 [346087] (3 species)
    Pfam PF04056
  7. 2468537Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346316] (1 PDB entry)
  8. 2468538Domain d4cr2w_: 4cr2 W: [345203]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2w_

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (W:) 26s proteasome regulatory subunit rpn10

SCOPe Domain Sequences for d4cr2w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2w_ c.62.1.1 (W:) Proteasome regulatory subunit Rpn10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvleatvlvidnseysrngdfprtrfeaqidsvefifqakrnsnpentvglisgaganpr
vlstftaefgkilaglhdtqiegklhmatalqiaqltlkhrqnkvqhqrivafvcspisd
srdelirlaktlkknnvavdiinfgeieqntelldefiaavnnpqeetshlltvtpgprl
lyeniasspiileegss

SCOPe Domain Coordinates for d4cr2w_:

Click to download the PDB-style file with coordinates for d4cr2w_.
(The format of our PDB-style files is described here.)

Timeline for d4cr2w_:

  • d4cr2w_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3