![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) ![]() |
![]() | Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins) |
![]() | Protein Carboxypeptidase A inhibitor [57034] (1 species) |
![]() | Species Potato [TaxId:4113] [57035] (2 PDB entries) |
![]() | Domain d4cpai_: 4cpa I: [44074] Other proteins in same PDB: d4cpaa_, d4cpab_ complexed with gly, zn |
PDB Entry: 4cpa (more details), 2.5 Å
SCOPe Domain Sequences for d4cpai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cpai_ g.3.2.1 (I:) Carboxypeptidase A inhibitor {Potato [TaxId: 4113]} zhadpicnkpckthddcsgawfcqacwnsartcgpyv
Timeline for d4cpai_: