Lineage for d4cnic_ (4cni C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992771Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1992811Protein Interleukin-6 [47272] (2 species)
  7. 1992812Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)
  8. 1992814Domain d4cnic_: 4cni C: [256633]
    Other proteins in same PDB: d4cnib1, d4cnib2, d4cnil1, d4cnil2
    automated match to d4ni9a_
    complexed with so4, tam

Details for d4cnic_

PDB Entry: 4cni (more details), 2.2 Å

PDB Description: crystal structure of the fab portion of olokizumab in complex with il- 6
PDB Compounds: (C:) interleukin-6

SCOPe Domain Sequences for d4cnic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cnic_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc
fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl
daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d4cnic_:

Click to download the PDB-style file with coordinates for d4cnic_.
(The format of our PDB-style files is described here.)

Timeline for d4cnic_: