Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Interleukin-6 [47272] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries) |
Domain d4cnic_: 4cni C: [256633] Other proteins in same PDB: d4cnib1, d4cnib2, d4cnil1, d4cnil2 automated match to d4ni9a_ complexed with so4, tam |
PDB Entry: 4cni (more details), 2.2 Å
SCOPe Domain Sequences for d4cnic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cnic_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
Timeline for d4cnic_: