Lineage for d4c92e_ (4c92 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787451Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries)
  8. 2787455Domain d4c92e_: 4c92 E: [228295]
    Other proteins in same PDB: d4c92b2
    automated match to d3swna_
    protein/RNA complex

Details for d4c92e_

PDB Entry: 4c92 (more details), 2.3 Å

PDB Description: Crystal structure of the yeast Lsm1-7 complex
PDB Compounds: (E:) U6 snRNA-associated Sm-like protein LSm5

SCOPe Domain Sequences for d4c92e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c92e_ b.38.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesrnek
vmqhhgrmllsgnniailvpggkk

SCOPe Domain Coordinates for d4c92e_:

Click to download the PDB-style file with coordinates for d4c92e_.
(The format of our PDB-style files is described here.)

Timeline for d4c92e_: