Lineage for d4c6wa1 (4c6w A:3-259)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.0: automated matches [196908] (1 protein)
not a true familyProtein automated matches [196909] (52 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [228163] (12 PDB entries) 
Domain d4c6wa1: 4c6w A:3-259 [228164]
automated match to d2gp6a1
complexed with epe, k, m7u, na, peg
Details for d4c6wa1
PDB Entry: 4c6w (more details), 1.7 Å
PDB Description: Crystal structure of M. tuberculosis C171Q KasA
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1SCOPe Domain Sequences for d4c6wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c6wa1 c.95.1.0 (A:3-259) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkigg
hlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaeri
vesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiahaw
rqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfgea
galmlieteehakarga
SCOPe Domain Coordinates for d4c6wa1:
Click to download the PDB-style file with coordinates for d4c6wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c6wa1:
- d4c6wa1 first appeared in SCOPe 2.03
- d4c6wa1 appears in SCOPe 2.04
- d4c6wa1 appears in SCOPe 2.06
- d4c6wa1 appears in the current release, SCOPe 2.08
View in 3D
