Lineage for d4c4za_ (4c4z A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) 
Protein automated matches [271870] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [271874] (57 PDB entries) 
Domain d4c4za_: 4c4z A: [271880]
automated match to d1s8oa2
complexed with w9l
Details for d4c4za_
PDB Entry: 4c4z (more details), 2.06 Å
PDB Description: crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2SCOPe Domain Sequences for d4c4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4za_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvl
amdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfyp
ervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslf
rasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnm
ernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmd
kptevnqilikwldsdar
SCOPe Domain Coordinates for d4c4za_:
Click to download the PDB-style file with coordinates for d4c4za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c4za_:
- d4c4za_ first appeared in SCOPe 2.05
- d4c4za_ appears in SCOPe 2.07
View in 3D
