Lineage for d4c4ko_ (4c4k O:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (26 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) 
Domain d4c4ko_: 4c4k O: [259754]
automated match to d3puca_
complexed with edo
Details for d4c4ko_
PDB Entry: 4c4k (more details), 1.95 Å
PDB Description: crystal structure of the titin m10-obscurin ig domain 1 complex
PDB Compounds: (O:) ObscurinSCOPe Domain Sequences for d4c4ko_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4ko_ b.1.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssaprfltrpkafvvsvgkdatlscqivgnptpqvswekdqqpvaagarfrlaqdgdlyr
ltildlalgdsgqyvcrarnaigeafaavglqvd
SCOPe Domain Coordinates for d4c4ko_:
Click to download the PDB-style file with coordinates for d4c4ko_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c4ko_:
- d4c4ko_ first appeared in SCOPe 2.04
- d4c4ko_ is called d4c4ko1 in SCOPe 2.06
- d4c4ko_ appears in the current release, SCOPe 2.08, called d4c4ko1
View in 3D
