Details for d4c3hg1

PDB Entry: 4c3h (more details), 3.27 Å

PDB Compounds: (G:) DNA-directed RNA polymerase I subunit rpa43

SCOPe Domain Sequences for d4c3hg1:

Sequence, based on SEQRES records: (download)

>d4c3hg1 d.230.1.2 (G:8-126) RNA polymerase I subunit A43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwq

Sequence, based on observed residues (ATOM records): (download)

>d4c3hg1 d.230.1.2 (G:8-126) RNA polymerase I subunit A43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadpldtseklikitpdtpfgftwchvnlyvwq

SCOPe Domain Coordinates for d4c3hg1:

Timeline for d4c3hg1:

• d4c3hg1 first appeared in SCOPe 2.07
  

Thumbnails for d4c3hg1:

d4c3hg1 (click for larger image) View in 3D

d4c3hg1 in context of chain d4c3hg2 in context of chain View in 3D Domains from same chain: (mouse over for more information) d4c3hg2

d4c3hg1 in context of PDB d4c3ha_ in context of PDB d4c3hb_ in context of PDB d4c3hc1 in context of PDB d4c3hc2 in context of PDB d4c3hd_ in context of PDB d4c3he1 in context of PDB d4c3he2 in context of PDB d4c3hf_ in context of PDB d4c3hh_ in context of PDB d4c3hi1 in context of PDB d4c3hi2 in context of PDB d4c3hj_ in context of PDB d4c3hk_ in context of PDB d4c3hl_ in context of PDB d4c3hm_ in context of PDB d4c3hn_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_