Lineage for d4c0sa3 (4c0s A:337-455)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794031Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259164] (2 PDB entries)
  8. 2794034Domain d4c0sa3: 4c0s A:337-455 [259167]
    Other proteins in same PDB: d4c0sa1, d4c0sa2, d4c0sb1, d4c0sb2
    automated match to d1f60a2
    complexed with gdp, mg

Details for d4c0sa3

PDB Entry: 4c0s (more details), 2.7 Å

PDB Description: mammalian translation elongation factor eef1a2
PDB Compounds: (A:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d4c0sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c0sa3 b.44.1.0 (A:337-455) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aaqftsqviilnhpgqisagyspvidchtahiackfaelkekidrrsgkklednpkslks
gdaaivemvpgkpmcvesfsqypplgrfavrdmrqtvavgviknvekksggagkvtksa

SCOPe Domain Coordinates for d4c0sa3:

Click to download the PDB-style file with coordinates for d4c0sa3.
(The format of our PDB-style files is described here.)

Timeline for d4c0sa3: