Lineage for d4bwua_ (4bwu A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
mono-domain proteins
Protein Pseudoazurin [49522] (4 species) Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries) 
Domain d4bwua_: 4bwu A: [257721]
automated match to d3erxa_
complexed with cu, so4; mutant
Details for d4bwua_
PDB Entry: 4bwu (more details), 1.76 Å
PDB Description: Three-dimensional structure of the K109A mutant of Paracoccus pantotrophus pseudoazurin at pH 5.5
PDB Compounds: (A:) pseudoazurinSCOPe Domain Sequences for d4bwua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bwua_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
qvn
SCOPe Domain Coordinates for d4bwua_:
Click to download the PDB-style file with coordinates for d4bwua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bwua_:
- d4bwua_ first appeared in SCOPe 2.04
- d4bwua_ appears in SCOPe 2.05
- d4bwua_ appears in SCOPe 2.07
- d4bwua_ appears in the current release, SCOPe 2.08
View in 3D
