Class a: All alpha proteins [46456] (289 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein automated matches [191131] (3 species) not a true protein |
Species Hepatitis B virus [TaxId:10407] [256206] (5 PDB entries) |
Domain d4bmga_: 4bmg A: [251276] automated match to d3kxse_ |
PDB Entry: 4bmg (more details), 3 Å
SCOPe Domain Sequences for d4bmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bmga_ a.62.1.1 (A:) automated matches {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstlp
Timeline for d4bmga_: