Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (8 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [197078] (1 PDB entry) |
Domain d4bbnf_: 4bbn F: [197079] Other proteins in same PDB: d4bbna_, d4bbnc_ automated match to d3noba_ |
PDB Entry: 4bbn (more details), 2.51 Å
SCOPe Domain Sequences for d4bbnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bbnf_ d.15.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgc
Timeline for d4bbnf_: