Lineage for d4baed_ (4bae D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667965Species Mycobacterium smegmatis [TaxId:1772] [228578] (1 PDB entry)
  8. 1667969Domain d4baed_: 4bae D: [228579]
    automated match to d4emva_
    complexed with ca, rwx, so4

Details for d4baed_

PDB Entry: 4bae (more details), 2.35 Å

PDB Description: optimisation of pyrroleamides as mycobacterial gyrb atpase inhibitors: structure activity relationship and in vivo efficacy in the mouse model of tuberculosis
PDB Compounds: (D:) DNA gyrase subunit b

SCOPe Domain Sequences for d4baed_:

Sequence, based on SEQRES records: (download)

>d4baed_ d.122.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrleatvlr
dgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlqemafln
kgltieltderdgkhrvfhypg

Sequence, based on observed residues (ATOM records): (download)

>d4baed_ d.122.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlhgvgvsvvnalstrleatvlrdgyewfqyydrsvpgkl
kqggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgkhrv
fhypg

SCOPe Domain Coordinates for d4baed_:

Click to download the PDB-style file with coordinates for d4baed_.
(The format of our PDB-style files is described here.)

Timeline for d4baed_: